PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10007713
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 117aa    MW: 13547.9 Da    PI: 10.3469
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10007713genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF466.8e-151156348
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                 i n+s  +v++ kR+ g++KK  EL++LCd++++ i   +++ +++
  Lus10007713 11 ITNESAMKVSLKKRKRGLMKKLRELCTLCDIQACAIANNPHDDMQT 56
                 8899******************************998887777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.582146IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-14162IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.18E-18299IPR002100Transcription factor, MADS-box
CDDcd002661.72E-17288No hitNo description
PRINTSPR004041.1E-6323IPR002100Transcription factor, MADS-box
PfamPF003196.0E-141155IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-62338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-63859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MTRKKVKLVC ITNESAMKVS LKKRKRGLMK KLRELCTLCD IQACAIANNP HDDMQTSETW  60
PPILGRVHEV LTCFKNMPNM DLAKNMVNRE EILSNWIKKT HNHRSNGAPR FDHERY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLVCITNESAMKVSLKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011463188.13e-28PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A0A0LVS33e-26A0A0A0LVS3_CUCSA; Uncharacterized protein
STRINGPOPTR_0005s00420.13e-26(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-16AGAMOUS-like 80